TA345220 NKRF antibody

Rabbit Polyclonal Anti-NKRF Antibody

See related secondary antibodies

Search for all "NKRF"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat NKRF

Product Description for NKRF

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat NKRF.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NKRF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ITBA4, ITBA4 protein, NF-kappa-B-repressing, NRF, factorTranscription factor NRF
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O15226
Immunogen:
The immunogen for anti-NKRF antibody: synthetic peptide directed towards the N terminal of human NKRF. Synthetic peptide located within the following region: MEKILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCDGQNPPKKQAGSK.
GeneID:
55922
Application WB
Background NKRF is a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptiol repression of certain NK-kappa-B-responsive genes. NKRF localizes predomintly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.This gene encodes a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptiol repression of certain NK-kappa-B-responsive genes. The protein localizes predomintly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NKRF (5 products)

Catalog No. Species Pres. Purity   Source  

NKRF

NKRF Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NKRF

NKRF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NKRF

NKRF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NKRF

NKRF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NKRF

NKRF Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for NKRF (2 products)

Catalog No. Species Pres. Purity   Source  

NKRF 293T Cell Transient Overexpression Lysate(Denatured)

NKRF 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NKRF Lysate

Western Blot: NKRF Lysate [NBL1-13657] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NKRF
  Novus Biologicals Inc.
  • LinkedIn