TA345226 ZNF407 antibody

Rabbit Polyclonal Anti-ZNF407 Antibody

See related secondary antibodies

Search for all "ZNF407"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat ZNF407

Product Description for ZNF407

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat ZNF407.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF407

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1703, Zinc finger protein 407
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9C0G0
Immunogen:
The immunogen for anti-ZNF407 antibody: synthetic peptide directed towards the middle region of human ZNF407. Synthetic peptide located within the following region: ESPTSVLEKPDRGNSIEAEVENVFHSLDGEVNSHLLDKKEQISSEPEDFA.
GeneID:
55628
Application WB
Background ZNF407 contains 22 C2H2-type zinc fingers. ZNF407 may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn