TA345227 BTBD2 antibody

Rabbit Polyclonal Anti-BTBD2 Antibody

See related secondary antibodies

Search for all "BTBD2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Zebrafish BTBD2

Product Description for BTBD2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Zebrafish BTBD2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BTBD2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTB/POZ domain-containing protein 2
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BX70
Immunogen:
The immunogen for Anti-BTBD2 antibody is: synthetic peptide directed towards the C-terminal region of Human BTBD2. Synthetic peptide located within the following region: NYTACATLKGPDSHYGTKGLRKVTHESPTTGAKTCFTFCYAAGNNNGTSV.
GeneID:
55643
Application WB
Background The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for BTBD2 (2 products)

Catalog No. Species Pres. Purity   Source  

BTBD2

BTBD2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BTBD2

BTBD2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn