TA345229 HIF1AN / FIH1 antibody

Rabbit Polyclonal Anti-HIF1AN Antibody

See related secondary antibodies

Search for all "HIF1AN / FIH1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human, Porcine, Rabbit HIF1AN / FIH1

Product Description for HIF1AN / FIH1

Rabbit anti Equine, Human, Porcine, Rabbit HIF1AN / FIH1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HIF1AN / FIH1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Factor inhibiting HIF-1, Hypoxia-inducible factor 1-alpha inhibitor, Hypoxia-inducible factor asparagine hydroxylase
Presentation Purified
Reactivity Eq, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NWT6
Immunogen:
The immunogen for anti-HIF1AN antibody: synthetic peptide directed towards the N terminal of human HIF1AN. Synthetic peptide located within the following region: MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDP.
GeneID:
55662
Application WB
Background HIF1AN is a co-repressor that interacts with hypoxia-inducible factor 1 (HIF-1) alpha and the von Hippel-Lindau tumor suppressor protein to mediate repression of HIF-1 transcriptiol activity.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HIF1AN / FIH1 (6 products)

Catalog No. Species Pres. Purity   Source  

HIF1AN / FIH1

HIF1AN / FIH1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

HIF1AN / FIH1 (1-349)

Recombinant HIF1AN, 1-349 aa: 15% SDS-PAGE (3 µg) Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €600.00
  OriGene Technologies GmbH

HIF1AN / FIH1 (1-349)

Recombinant HIF1AN, 1-349 aa: 15% SDS-PAGE (3 µg) Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €250.00
  OriGene Technologies GmbH

HIF1AN / FIH1

HIF1AN / FIH1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HIF1AN / FIH1

HIF1AN / FIH1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HIF1AN / FIH1

HIF1AN / FIH1 Protein
  Novus Biologicals Inc.

Positive controls for HIF1AN / FIH1 (3 products)

Catalog No. Species Pres. Purity   Source  

Factor Inhibiting HIF-1 Lysate

Western Blot: Factor Inhibiting HIF-1 Lysate [NBL1-11541] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for HIF1AN.
  Novus Biologicals Inc.

HIF1AN 293T Cell Transient Overexpression Lysate(Denatured)

HIF1AN 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HIF1AN overexpression lysate

HIF1AN overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn