TA345271 WDR45L / WIPI-3 antibody

Rabbit Polyclonal Anti-Wdr45l Antibody

See related secondary antibodies

Search for all "WDR45L / WIPI-3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish WDR45L / WIPI-3

Product Description for WDR45L / WIPI-3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish WDR45L / WIPI-3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for WDR45L / WIPI-3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms WD repeat domain phosphoinositide-interacting protein 3, WD repeat-containing protein 45-like, WDR45-like protein, WIPI3, WIPI49-like protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9CR39
Immunogen:
The immunogen for Anti-Wdr45l antibody is: synthetic peptide directed towards the C-terminal region of Rat Wdr45l. Synthetic peptide located within the following region: SPCICAFGTEPNAVIAICADGSYYKFLFSPKGECVRDVCAQFLEMTDDKL.
GeneID:
66840
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn