TA345274 POLE4 antibody

Rabbit Polyclonal Anti-POLE4 Antibody

See related secondary antibodies

Search for all "POLE4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rat POLE4

Product Description for POLE4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rat POLE4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for POLE4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DNA polymerase II subunit 4, DNA polymerase epsilon subunit 4, DNA polymerase epsilon subunit p12
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NR33
Immunogen:
The immunogen for anti-POLE4 antibody: synthetic peptide directed towards the N terminal of human POLE4. Synthetic peptide located within the following region: MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALV.
GeneID:
56655
Application WB
Background POLE4 is a histone-fold protein that interacts with other histone-fold proteins to bind D in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for D transcription, replication, and packaging.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for POLE4 (2 products)

Catalog No. Species Pres. Purity   Source  

POLE4

POLE4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

POLE4

POLE4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for POLE4 (1 products)

Catalog No. Species Pres. Purity   Source  

POLE4 Lysate

POLE4 Lysate
  Novus Biologicals Inc.
  • LinkedIn