TA345307 ZBTB26 antibody

Rabbit Polyclonal Anti-ZBTB26 Antibody

See related secondary antibodies

Search for all "ZBTB26"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat ZBTB26

Product Description for ZBTB26

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat ZBTB26.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZBTB26

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1572, ZNF481, Zinc finger and BTB domain-containing protein 26, Zinc finger protein 481, Zinc finger protein Bioref
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HCK0
Immunogen:
The immunogen for anti-ZBTB26 antibody: synthetic peptide directed towards the N terminal of human ZBTB26. Synthetic peptide located within the following region: MSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDIEVQGHKIV.
GeneID:
57684
Application WB
Background ZBTB26 contains 4 C2H2-type zinc fingers. It may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZBTB26 (2 products)

Catalog No. Species Pres. Purity   Source  

ZBTB26

ZBTB26 Human Purified
  Abnova Taiwan Corp.

ZBTB26

ZBTB26 Human Purified
  Abnova Taiwan Corp.

Positive controls for ZBTB26 (2 products)

Catalog No. Species Pres. Purity   Source  

ZBTB26 293T Cell Transient Overexpression Lysate(Denatured)

ZBTB26 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZBTB26 overexpression lysate

ZBTB26 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn