TA345329 HOXA11 / HOX1I antibody

Rabbit Polyclonal Anti-HOXA11 Antibody

See related secondary antibodies

Search for all "HOXA11 / HOX1I"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish HOXA11 / HOX1I

Product Description for HOXA11 / HOX1I

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish HOXA11 / HOX1I.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HOXA11 / HOX1I

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein Hox-A11, Hox-1I
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P31270
Immunogen:
The immunogen for Anti-HOXA11 antibody is: synthetic peptide directed towards the C-terminal region of Human HOXA11. Synthetic peptide located within the following region: FFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKINRDRLQYYSAN.
GeneID:
3207
Application WB
Background In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters med A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a D-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is involved in the regulation of uterine development and is required for female fertility. Mutations in this gene can cause radio-ulr synostosis with amegakaryocytic thrombocytopenia.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HOXA11 / HOX1I (4 products)

Catalog No. Species Pres. Purity   Source  

HOXA11 / HOX1I

HOXA11 / HOX1I Human Purified
  Abnova Taiwan Corp.

HOXA11 / HOX1I

HOXA11 / HOX1I Human Purified
  Abnova Taiwan Corp.

HOXA11 / HOX1I

HOXA11 / HOX1I Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HOXA11 / HOX1I

HOXA11 / HOX1I Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for HOXA11 / HOX1I (2 products)

Catalog No. Species Pres. Purity   Source  

HOXA11 Lysate

Western Blot: HOXA11 Lysate [NBL1-11665] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HOXA11
  Novus Biologicals Inc.

HOXA11 overexpression lysate

HOXA11 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn