TA345330 ZNF71 antibody

Rabbit Polyclonal Anti-ZNF71 Antibody

See related secondary antibodies

Search for all "ZNF71"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Yeast ZNF71

Product Description for ZNF71

Rabbit anti Human, Yeast ZNF71.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF71

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EZFIT, Endothelial zinc finger protein induced by tumor necrosis factor alpha, Zinc finger protein 71
Presentation Purified
Reactivity Hu, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQZ8
Immunogen:
The immunogen for anti-ZNF71 antibody: synthetic peptide directed towards the N terminal of human ZNF71. Synthetic peptide located within the following region: MKELDPKNDISEDKLSVVGEATGGPTRNGARGPGSEGVWEPGSWPERPRG.
GeneID:
58491
Application WB
Background ZNF71 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF71 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF71

ZNF71 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF71

ZNF71 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF71

ZNF71 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF71

ZNF71 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF71 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF71 293T Cell Transient Overexpression Lysate(Denatured)

ZNF71 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn