TA345331 ZNF71 antibody

Rabbit Polyclonal Anti-ZNF71 Antibody

See related secondary antibodies

Search for all "ZNF71"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Drosophila, Human, Mouse, Rat ZNF71

TA345331

More Views

  • TA345331
  • TA345331
  • TA345331
  • TA345331

Product Description for ZNF71

Rabbit anti Bovine, Drosophila, Human, Mouse, Rat ZNF71.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZNF71

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EZFIT, Endothelial zinc finger protein induced by tumor necrosis factor alpha, Zinc finger protein 71
Presentation Aff - Purified
Reactivity Bov, Dros, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Molecular weight 54 kDa (489 aa)
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQZ8
Immunogen:
A synthetic peptide located within the following region of human ZNF71:
AA Sequence:
RCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRIH
GeneID:
58491
Application Western blotting.
Immunohistochemistry on paraffin embedded tissue.
Background Zinc finger protein 71, belonging to the krueppel C2H2-type zinc-finger protein family, may be involved in transcriptional regulation.
Concentration 1.0 mg/ml after reconstitution
General Readings Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human, Mouse, Rat, Bovine, Fruit fly

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF71 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF71

ZNF71 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF71

ZNF71 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF71

ZNF71 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF71

ZNF71 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF71 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF71 293T Cell Transient Overexpression Lysate(Denatured)

ZNF71 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn