TA345338 FOXA2 / HNF3B antibody

Rabbit Polyclonal Anti-FOXA2 Antibody

See related secondary antibodies

Search for all "FOXA2 / HNF3B"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish FOXA2 / HNF3B

Product Description for FOXA2 / HNF3B

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish FOXA2 / HNF3B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FOXA2 / HNF3B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HNF-3-beta, HNF-3B, Hepatocyte nuclear factor 3-beta, TCF3B, Transcription factor 3B
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y261
Immunogen:
The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the N terminal of human FOXA2. Synthetic peptide located within the following region: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAA.
GeneID:
3170
Application WB
Background FOXA2 is a member of the forkhead class of D-binding proteins. These hepatocyte nuclear factors are transcriptiol activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young.This gene encodes a member of the forkhead class of D-binding proteins. These hepatocyte nuclear factors are transcriptiol activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FOXA2 / HNF3B (4 products)

Catalog No. Species Pres. Purity   Source  

FOXA2 / HNF3B

FOXA2 / HNF3B Human Purified
  Abnova Taiwan Corp.

FOXA2 / HNF3B

FOXA2 / HNF3B Human Purified
  Abnova Taiwan Corp.

FOXA2 / HNF3B

FOXA2 / HNF3B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FOXA2 / HNF3B

FOXA2 / HNF3B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for FOXA2 / HNF3B (2 products)

Catalog No. Species Pres. Purity   Source  

FOXA2 Lysate

Western Blot: FOXA2 Lysate [NBL1-10799] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FOXA2
  Novus Biologicals Inc.

FOXA2 overexpression lysate

FOXA2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn