TA345342 ZNF70 antibody

Rabbit Polyclonal Anti-ZNF70 Antibody

See related secondary antibodies

Search for all "ZNF70"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF70

Product Description for ZNF70

Rabbit anti Human ZNF70.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF70

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 70
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UC06
Immunogen:
The immunogen for anti-ZNF70 antibody: synthetic peptide directed towards the N terminal of human ZNF70. Synthetic peptide located within the following region: MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKE.
GeneID:
7621
Application WB
Background The function of the ZNF70 gene has not yet been determined
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF70 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF70

ZNF70 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

ZNF70 (full length, N-term HIS tag)

ZNF70 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ZNF70

ZNF70 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF70

ZNF70 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF70 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF70 293T Cell Transient Overexpression Lysate(Denatured)

ZNF70 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF70 Lysate

Western Blot: ZNF70 Lysate [NBL1-18234] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF70
  Novus Biologicals Inc.
  • LinkedIn