TA345372 JMJD4 antibody

Rabbit Polyclonal Anti-JMJD4 Antibody

See related secondary antibodies

Search for all "JMJD4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human JMJD4

Product Description for JMJD4

Rabbit anti Human JMJD4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for JMJD4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms JmjC domain-containing protein 4, Jumonji domain-containing protein 4
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H9V9
Immunogen:
The immunogen for anti-JMJD4 antibody: synthetic peptide directed towards the N terminal of human JMJD4. Synthetic peptide located within the following region: MRAGPEPQALVGQKRGALRLLVPRLVLTVSAPAEVRRRVLRPVLSWMDRE.
GeneID:
65094
Application WB
Background The function of JMJD4 remains unkonwn.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for JMJD4 (1 products)

Catalog No. Species Pres. Purity   Source  

JMJD4 overexpression lysate

JMJD4 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn