TA345377 HOXB4 / HOX2F antibody

Rabbit Polyclonal Anti-HOXB4 Antibody

See related secondary antibodies

Search for all "HOXB4 / HOX2F"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat HOXB4 / HOX2F

Product Description for HOXB4 / HOX2F

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat HOXB4 / HOX2F.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HOXB4 / HOX2F

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein Hox-B4, Hox-2.6, Hox-2F
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P17483
Immunogen:
The immunogen for anti-HOXB4 antibody: synthetic peptide directed towards the N terminal of human HOXB4. Synthetic peptide located within the following region: FLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFG.
GeneID:
3214
Application WB
Background HOXB4 is a nuclear protein with a homeobox D-binding domain. The protein functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox D-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HOXB4 / HOX2F (2 products)

Catalog No. Species Pres. Purity   Source  

HOXB4 / HOX2F

HOXB4 / HOX2F Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HOXB4 / HOX2F

HOXB4 / HOX2F Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for HOXB4 / HOX2F (2 products)

Catalog No. Species Pres. Purity   Source  

HOXB4 Lysate

Western Blot: HOXB4 Lysate [NBL1-11671] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HOXB4
  Novus Biologicals Inc.

HOXB4 overexpression lysate

HOXB4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn