TA345380 Insulin promoter factor 1 antibody

Rabbit Polyclonal Anti-Pdx1 Antibody

See related secondary antibodies

Search for all "Insulin promoter factor 1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish Insulin promoter factor 1

Product Description for Insulin promoter factor 1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish Insulin promoter factor 1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Insulin promoter factor 1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GSF, Glucose-sensitive factor, IDX-1, IPF-1, IPF1, IUF-1, Insulin promoter factor 1, Insulin upstream factor 1, Islet/duodenum homeobox-1, PDX-1, PDX1, Pancreas/duodenum homeobox protein 1, STF-1, Somatostatin-transactivating factor 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P52947
Immunogen:
The immunogen for Anti-Pdx1 antibody is: synthetic peptide directed towards the middle region of Rat Pdx1. Synthetic peptide located within the following region: ISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTTSGGGGG.
GeneID:
29535
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn