TA345425 MAD3 antibody

Rabbit Polyclonal Anti-MXD3 Antibody

See related secondary antibodies

Search for all "MAD3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish MAD3

Product Description for MAD3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish MAD3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MAD3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MAD-3, MXD3, Max-interacting transcriptional repressor MAD3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BW11
Immunogen:
The immunogen for anti-MXD3 antibody: synthetic peptide directed towards the N terminal of human MXD3. Synthetic peptide located within the following region: MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQ.
GeneID:
83463
Application WB
Background MXD3 contains 1 basic helix-loop-helix (bHLH) domain. It is a transcriptiol repressor and binds with MAX to form a sequence-specific D-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptiol activity by competing for MAX and suppresses MYC dependent cell transformation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MAD3 (5 products)

Catalog No. Species Pres. Purity   Source  

MAD3 (transcript variant 1)

MAD3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MAD3 (1-206, His-tag)

MAD3 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

MAD3 (1-206, His-tag)

MAD3 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

MAD3

MAD3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MAD3

MAD3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for MAD3 (3 products)

Catalog No. Species Pres. Purity   Source  

MAD3 Lysate

Western Blot: MAD3 Lysate [NBL1-13407] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MXD3
  Novus Biologicals Inc.

MXD3 293T Cell Transient Overexpression Lysate(Denatured)

MXD3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MXD3 overexpression lysate

MXD3 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn