TA345458 ZNF514 antibody

Rabbit Polyclonal Anti-ZNF514 Antibody

See related secondary antibodies

Search for all "ZNF514"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZNF514

Product Description for ZNF514

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZNF514.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF514

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 514
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96K75
Immunogen:
The immunogen for anti-ZNF514 antibody: synthetic peptide directed towards the middle region of human ZNF514. Synthetic peptide located within the following region: GRAFSQSSSLTQHYRFHTGEKPYKCNECGRAFAHTASLIKHQRSHAGKKT.
GeneID:
84874
Application WB
Background ZNF514 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 KRAB domain. ZNF514 may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF514 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF514 (1-400, His-tag)

ZNF514 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

ZNF514 (1-400, His-tag)

ZNF514 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

ZNF514

ZNF514 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF514

ZNF514 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF514 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF514 293T Cell Transient Overexpression Lysate(Denatured)

ZNF514 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn