TA345460 ATOH8 antibody

Rabbit Polyclonal Anti-ATOH8 Antibody

See related secondary antibodies

Search for all "ATOH8"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ATOH8

TA345460

Product Description for ATOH8

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ATOH8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ATOH8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Helix-loop-helix protein hATH-6, Protein atonal homolog 8, hATH-6, hATH6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96SQ7
Immunogen:
The immunogen for anti-ATOH8 antibody: synthetic peptide directed towards the N terminal of human ATOH8. Synthetic peptide located within the following region: PWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGL.
GeneID:
84913
Application WB
Background The function of ATOH8 remains unknown.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ATOH8 (2 products)

Catalog No. Species Pres. Purity   Source  

ATOH8

ATOH8 Human Purified
  Abnova Taiwan Corp.

ATOH8

ATOH8 Human Purified
  Abnova Taiwan Corp.

Positive controls for ATOH8 (1 products)

Catalog No. Species Pres. Purity   Source  

ATOH8 overexpression lysate

ATOH8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn