TA345479 BTBD6 / BDPL antibody

Rabbit Polyclonal Anti-BTBD6 Antibody

See related secondary antibodies

Search for all "BTBD6 / BDPL"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Rabbit, Zebrafish BTBD6 / BDPL

TA345479

More Views

  • TA345479

Product Description for BTBD6 / BDPL

Rabbit anti Bovine, Equine, Guinea Pig, Human, Rabbit, Zebrafish BTBD6 / BDPL.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for BTBD6 / BDPL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTB/POZ domain-containing protein 6, Lens BTB domain protein
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Rb, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96KE9
Immunogen:
The immunogen for anti-BTBD6 antibody: synthetic peptide directed towards the N terminal of human BTBD6. Synthetic peptide located within the following region: FVVGPPGATRTVPAHKYVLAVGSSVFYAMFYGDLAEVKSEIHIPDVEPAA.
GeneID:
90135
Application WB
IHC
Background The function remains unknown.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for BTBD6 / BDPL (2 products)

Catalog No. Species Pres. Purity   Source  

BTBD6 Lysate

Western Blot: BTBD6 Lysate [NBL1-08042] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for BTBD6 Protein
  Novus Biologicals Inc.

BTBD6 overexpression lysate

BTBD6 overexpression lysate
  OriGene Technologies, Inc.
  • LinkedIn