TA345492 ZNF545 antibody

Rabbit Polyclonal Anti-ZNF545 Antibody

See related secondary antibodies

Search for all "ZNF545"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZNF545

Product Description for ZNF545

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZNF545.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF545

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1948, ZFP82, Zfp-82, Zinc finger protein 545, Zinc finger protein 82 homolog
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N141
Immunogen:
The immunogen for anti-ZNF545 antibody: synthetic peptide directed towards the C terminal of human ZNF545. Synthetic peptide located within the following region: CRKAFRLNSSLIQHLRIHSGEKPYECKECKKAFRQHSHLTHHLKIHNVKI.
GeneID:
284406
Application WB
Background ZNF545 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF545 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF545 (full length, N-term HIS tag)

ZNF545 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ZNF545

ZNF545 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF545

ZNF545 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF545 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF545 293T Cell Transient Overexpression Lysate(Denatured)

ZNF545 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF545 Lysate

Western Blot: ZNF545 Lysate [NBL1-18023] - Western Blot experiments. Left-Control; Right -Over-expression Lysate
  Novus Biologicals Inc.
  • LinkedIn