TA345502 ZNF655 antibody

Rabbit Polyclonal Anti-ZNF655 Antibody

See related secondary antibodies

Search for all "ZNF655"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZNF655

Product Description for ZNF655

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZNF655.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF655

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms VIK, Vav-interacting Krueppel-like protein, Zinc finger protein 655
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N720
Immunogen:
The immunogen for anti-ZNF655 antibody: synthetic peptide directed towards the middle region of human ZNF655. Synthetic peptide located within the following region: EGSFSHSSDLILQQEVLTRQKAFDCDVWEKNSSQRAHLVQHQSIHTKENS.
GeneID:
79027
Application WB
Background ZNF655 is a zinc finger protein. The zinc finger proteins are involved in D binding and protein-protein interactions. This gene encodes a zinc finger protein. The zinc finger proteins are involved in D binding and protein-protein interactions. Multiple altertively spliced transcript variants encoding distinct isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF655 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF655 (N-term HIS tag, transcript variant 3)

ZNF655 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.
  • LinkedIn