TA345517 ZNF498 antibody

Rabbit Polyclonal Anti-ZNF498 Antibody

See related secondary antibodies

Search for all "ZNF498"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat ZNF498

Product Description for ZNF498

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat ZNF498.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF498

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger and SCAN domain-containing protein 25, Zinc finger protein 498
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NSZ9
Immunogen:
The immunogen for anti-ZNF498 antibody: synthetic peptide directed towards the C terminal of human ZNF498. Synthetic peptide located within the following region: FSKGERLVRHQRIHTGEKPYHCPACGRSFNQRSILNRHQKTQHRQEPLVQ.
GeneID:
221785
Application WB
Background The function of ZNF498 remains unknown. The protein bears some similarity to zinc finger proteins, which are involved in D binding and protein-protein interactions. Altertive splicing results in two transcript variants encoding different proteins. Additiol splice variants have been identified, but their biological validity has not been determined
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF498 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF498

ZNF498 Human Purified
  Abnova Taiwan Corp.

ZNF498

ZNF498 Human Purified
  Abnova Taiwan Corp.

Positive controls for ZNF498 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF498 293T Cell Transient Overexpression Lysate(Denatured)

ZNF498 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZSCAN25 overexpression lysate

ZSCAN25 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn