TA345518 HMGB4 antibody

Rabbit Polyclonal Anti-HMGB4 Antibody

See related secondary antibodies

Search for all "HMGB4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat HMGB4

Product Description for HMGB4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat HMGB4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HMGB4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms High mobility group protein B4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WW32
Immunogen:
The immunogen for anti-HMGB4 antibody: synthetic peptide directed towards the N terminal of human HMGB4. Synthetic peptide located within the following region: MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPNTYVGFKEFSRKCSEKWR.
GeneID:
127540
Application WB
Background HMGB4 contains two HMG-box regions, which is found in a variety of eukaryotic chromosomal proteins and transcription.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for HMGB4 (3 products)

Catalog No. Species Pres. Purity   Source  

HMGB4 Lysate

Western Blot: HMGB4 Lysate [NBL1-11616] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HMGB4
  Novus Biologicals Inc.

HMGB4 overexpression lysate

HMGB4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

HMGB4 overexpression lysate

HMGB4 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn