TA345527 ZNF396 antibody

Rabbit Polyclonal Anti-ZNF396 Antibody

See related secondary antibodies

Search for all "ZNF396"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZNF396

Product Description for ZNF396

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZNF396.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF396

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ZSCAN14, Zinc finger and SCAN domain-containing protein 14, Zinc finger protein 396
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96N95
Immunogen:
The immunogen for anti-ZNF396 antibody: synthetic peptide directed towards the N terminal of human ZNF396. Synthetic peptide located within the following region: TQTSEECNGILTEKMEEEEQTCDPDSSLHWSSSYSPETFRQQFRQFGYQD.
GeneID:
252884
Application WB
Background ZNF396 acts as a D-dependent transcriptiol repressor.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF396 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF396

ZNF396 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF396

ZNF396 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF396

ZNF396 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF396

ZNF396 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF396 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF396 293T Cell Transient Overexpression Lysate(Denatured)

ZNF396 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn