TA345529 Islet-2 / ISL2 antibody

Rabbit Polyclonal Anti-ISL2 Antibody

See related secondary antibodies

Search for all "Islet-2 / ISL2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Islet-2 / ISL2

Product Description for Islet-2 / ISL2

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Islet-2 / ISL2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Islet-2 / ISL2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Insulin gene enhancer protein ISL-2
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96A47
Immunogen:
The immunogen for anti-ISL2 antibody: synthetic peptide directed towards the N terminal of human ISL2. Synthetic peptide located within the following region: MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHC.
GeneID:
64843
Application WB
Background ISL2 is the transcriptiol factor that defines subclasses of motoneurons that segregate into columns in the spil cord and select distinct axon pathways.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Islet-2 / ISL2 (4 products)

Catalog No. Species Pres. Purity   Source  

Islet-2 / ISL2

Islet-2 / ISL2 Human Purified
  Abnova Taiwan Corp.

Islet-2 / ISL2

Islet-2 / ISL2 Human Purified
  Abnova Taiwan Corp.

Islet-2 / ISL2

Islet-2 / ISL2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Islet-2 / ISL2

Islet-2 / ISL2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Islet-2 / ISL2 (2 products)

Catalog No. Species Pres. Purity   Source  

ISL2 293T Cell Transient Overexpression Lysate(Denatured)

ISL2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ISL2 overexpression lysate

ISL2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn