TA345535 ZNF641 antibody

Rabbit Polyclonal Anti-ZNF641 Antibody

See related secondary antibodies

Search for all "ZNF641"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZNF641

Product Description for ZNF641

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZNF641.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF641

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 641
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96N77
Immunogen:
The immunogen for anti-ZNF641 antibody: synthetic peptide directed towards the middle region of human ZNF641. Synthetic peptide located within the following region: RHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQGQSPRNSWDRGTSVF.
GeneID:
121274
Application WB
Background ZNF641 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers and 1 KRAB domain. ZNF641 activates transcriptiol activities of SRE and AP-1.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF641 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF641 overexpression lysate

ZNF641 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn