TA345537 SPIC antibody

Rabbit Polyclonal Anti-SPIC Antibody

See related secondary antibodies

Search for all "SPIC"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Porcine SPIC

Product Description for SPIC

Rabbit anti Bovine, Equine, Human, Porcine SPIC.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SPIC

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Transcription factor Spi-C
Presentation Purified
Reactivity Bov, Eq, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N5J4
Immunogen:
The immunogen for anti-SPIC antibody: synthetic peptide directed towards the middle region of human SPIC. Synthetic peptide located within the following region: LQRLSPSYFLGKEIFYSQCVQPDQEYLSLNNWNANYNYTYANYHELNHHD.
GeneID:
121599
Application WB
Background SPIC controls the development of red pulp macrophages required for red blood cells recycling and iron homeostasis. SPIC is a transcription factor that binds to the PU-box, a purine-rich D sequence (5'-GAGGA[AT]-3') that can act as a lymphoid-specific enhancer. SPIC regulates VCAM1 gene expression.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SPIC (4 products)

Catalog No. Species Pres. Purity   Source  

SPIC (full length, N-term HIS tag)

SPIC Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

SPIC

SPIC Human in vitro transl.
  Abnova Taiwan Corp.

SPIC

SPIC Human in vitro transl.
  Abnova Taiwan Corp.

SPIC

SPIC Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SPIC (2 products)

Catalog No. Species Pres. Purity   Source  

SPIC Lysate

Western Blot: SPIC Lysate [NBL1-16400] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SPIC
  Novus Biologicals Inc.

SPIC overexpression lysate

SPIC overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn