TA345539 ZNF440 antibody

Rabbit Polyclonal Anti-ZNF440 Antibody

See related secondary antibodies

Search for all "ZNF440"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF440

Product Description for ZNF440

Rabbit anti Human ZNF440.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF440

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 440
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IYI8
Immunogen:
The immunogen for anti-ZNF440 antibody: synthetic peptide directed towards the N terminal of human ZNF440. Synthetic peptide located within the following region: VNFTQEEWALLDISQRKLYREVMLETFRNLTSLGKRWKDQNIEYEHQNPR.
GeneID:
126070
Application WB
Background ZNF440 contains 1 KRAB domain and 12 C2H2-type zinc fingers. ZNF440 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptiol regulation.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn