TA345540 KBTBD5 / SRYP antibody

Rabbit Polyclonal Anti-KBTBD5 Antibody

See related secondary antibodies

Search for all "KBTBD5 / SRYP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KBTBD5 / SRYP

Product Description for KBTBD5 / SRYP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KBTBD5 / SRYP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KBTBD5 / SRYP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Kelch repeat and BTB domain-containing protein 5, Sarcosynapsin
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2TBA0
Immunogen:
The immunogen for anti-KBTBD5 antibody: synthetic peptide directed towards the C terminal of human KBTBD5. Synthetic peptide located within the following region: ELVPTELNDIWRYNEEEKKWEGVLREIAYAAGATFLPVRLNVLCLTKM.
GeneID:
131377
Application WB
Background The exact function of KBTBD5 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KBTBD5 / SRYP (1 products)

Catalog No. Species Pres. Purity   Source  

KBTBD5 / SRYP

KBTBD5 / SRYP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for KBTBD5 / SRYP (1 products)

Catalog No. Species Pres. Purity   Source  

KBTBD5 Lysate

Western Blot: KBTBD5 Lysate [NBL1-12133] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KBTBD5
  Novus Biologicals Inc.
  • LinkedIn