TA345548 ZNF569 antibody

Rabbit Polyclonal Anti-ZNF569 Antibody

See related secondary antibodies

Search for all "ZNF569"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat ZNF569

Product Description for ZNF569

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat ZNF569.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF569

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 569
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5MCW4
Immunogen:
The immunogen for anti-ZNF569 antibody: synthetic peptide directed towards the N terminal of human ZNF569. Synthetic peptide located within the following region: MTESQGTVTFKDVAIDFTQEEWKRLDPAQRKLYRNVMLENYNNLITVGYP.
GeneID:
148266
Application WB
Background ZNF569 may be involved in transcriptiol regulation
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn