TA345552 ZNF645 antibody

Rabbit Polyclonal Anti-ZNF645 Antibody

See related secondary antibodies

Search for all "ZNF645"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF645

Product Description for ZNF645

Rabbit anti Human ZNF645.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF645

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 645
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 49 kDa (425 aa)
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N7E2
Immunogen:
A synthetic peptide directed towards the middle region of human ZNF645
AA Sequence:
LSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRR
GeneID:
158506
Application Western blotting: 0.2 -1.0 µg/ml.
Background ZNF645 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions.
Concentration 1.0 mg/ml
General Readings Ross,M.T., (2005) Nature 434 (7031), 325-337.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF645 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF645 overexpression lysate

ZNF645 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn