TA345555 ZNF567 antibody

Rabbit Polyclonal Anti-ZNF567 Antibody

See related secondary antibodies

Search for all "ZNF567"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat ZNF567

Product Description for ZNF567

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat ZNF567.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF567

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 567
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N184
Immunogen:
The immunogen for anti-ZNF567 antibody: synthetic peptide directed towards the N terminal of human ZNF567. Synthetic peptide located within the following region: TSFAGHTCLEENWKAEDFLVKFKEHQEKYSRSVVSINHKKLVKEKSKIYE.
GeneID:
163081
Application WB
Background ZNF567 may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF567 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF567

ZNF567 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZNF567

ZNF567 Human
  Abnova Taiwan Corp.

ZNF567

ZNF567 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

ZNF567

ZNF567 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Positive controls for ZNF567 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF567 293T Cell Transient Overexpression Lysate(Denatured)

ZNF567 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn