TA345588 EYA4 antibody

Rabbit Polyclonal Anti-Eya4 Antibody

See related secondary antibodies

Search for all "EYA4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Guinea Pig, Human, Mouse, Rabbit, Zebrafish EYA4

Product Description for EYA4

Rabbit anti Canine, Guinea Pig, Human, Mouse, Rabbit, Zebrafish EYA4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EYA4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Eyes absent homolog 4
Presentation Purified
Reactivity Can, GP, Hu, Ms, Rb, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Z191
Immunogen:
The immunogen for Anti-Eya4 antibody is: synthetic peptide directed towards the N-terminal region of Eya4. Synthetic peptide located within the following region: MEDTQDLNEQSVKKTCPEADVSEPQNSRSMEMQDLASPHALVGGSDTPGS.
GeneID:
14051
Application WB
Background Eya4 is a tyrosine phosphatase that specifically dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph). 'Tyr-142' phosphorylation of histone H2AX plays a central role in D repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Eya4 promotes efficient D repair by dephosphorylating H2AX, promoting the recruitment of D repair complexes containing MDC1. Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis. It may be involved in development of the eye.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn