TA345592 ZNF57 antibody

Rabbit Polyclonal Anti-ZNF57 Antibody

See related secondary antibodies

Search for all "ZNF57"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human, Mouse, Porcine, Rat, Zebrafish ZNF57

Product Description for ZNF57

Rabbit anti Equine, Human, Mouse, Porcine, Rat, Zebrafish ZNF57.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF57

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ZNF424, Zinc finger protein 424, Zinc finger protein 57
Presentation Purified
Reactivity Eq, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q68EA5
Immunogen:
The immunogen for anti-ZNF57 antibody: synthetic peptide directed towards the C terminal of human ZNF57. Synthetic peptide located within the following region: LHNHVRMHTGEKPHKCKQCGMSFKWHSSFRNHLRMHTGQKSHECQSYSKA.
GeneID:
126295
Application WB
Background The function of ZNF57 remains unkonwn.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF57 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF57

ZNF57 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF57

ZNF57 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF57 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF57 293T Cell Transient Overexpression Lysate(Denatured)

ZNF57 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn