TA345594 ZNF596 antibody

Rabbit Polyclonal Anti-ZNF596 Antibody

See related secondary antibodies

Search for all "ZNF596"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rat ZNF596

Product Description for ZNF596

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rat ZNF596.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF596

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 596
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TC21
Immunogen:
The immunogen for anti-ZNF596 antibody: synthetic peptide directed towards the C terminal of human ZNF596. Synthetic peptide located within the following region: CGKAFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHRRVHTGEK.
GeneID:
169270
Application WB
Background ZNF596 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptiol regulation.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF596 (5 products)

Catalog No. Species Pres. Purity   Source  

ZNF596 (N-term HIS tag, transcript variant 2)

ZNF596 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ZNF596 (N-term HIS tag, transcript variant 3)

ZNF596 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ZNF596

ZNF596 Human
  Abnova Taiwan Corp.

ZNF596

ZNF596 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

ZNF596

ZNF596 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Positive controls for ZNF596 (5 products)

Catalog No. Species Pres. Purity   Source  

ZNF596 293T Cell Transient Overexpression Lysate(Denatured)

ZNF596 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF596 Lysate

Western Blot: ZNF596 Lysate [NBL1-18202] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF596
  Novus Biologicals Inc.

ZNF596 overexpression lysate

ZNF596 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

ZNF596 overexpression lysate

ZNF596 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

ZNF596 overexpression lysate

ZNF596 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn