TA345609 TFAP2E antibody

Rabbit Polyclonal Anti-TFAP2E Antibody

See related secondary antibodies

Search for all "TFAP2E"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat TFAP2E

Product Description for TFAP2E

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat TFAP2E.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TFAP2E

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Activating enhancer-binding protein 2 epsilon, Transcription factor AP-2 epsilon
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6VUC0
Immunogen:
The immunogen for anti-TFAP2E antibody: synthetic peptide directed towards the C terminal of human TFAP2E. Synthetic peptide located within the following region: FGGPAICAALTAFQNYLLESLKGLDKMFLSSVGSGHGETKASEKDAKHRK.
GeneID:
339488
Application WB
Background TFAP2E belongs to AP-2 family of transcription factors which play an important role in regulating gene expression during development and differentiation of multiple organs and tissues. It may play an important role in skin biology.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TFAP2E (2 products)

Catalog No. Species Pres. Purity   Source  

TFAP2E

TFAP2E Human Purified
  Abnova Taiwan Corp.

TFAP2E

TFAP2E Human Purified
  Abnova Taiwan Corp.

Positive controls for TFAP2E (1 products)

Catalog No. Species Pres. Purity   Source  

TFAP2E 293T Cell Transient Overexpression Lysate(Denatured)

TFAP2E 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn