TA345614 FOXK2 / ILF1 antibody

Rabbit Polyclonal Anti-FOXK2 Antibody

See related secondary antibodies

Search for all "FOXK2 / ILF1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FOXK2 / ILF1

Product Description for FOXK2 / ILF1

Rabbit anti Human FOXK2 / ILF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FOXK2 / ILF1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cellular transcription factor ILF-1, FOXK1, Forkhead box protein K2, ILF, ILF-1, Interleukin enhancer-binding factor 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q01167
Immunogen:
The immunogen for anti-FOXK2 antibody: synthetic peptide directed towards the C terminal of human FOXK2. Synthetic peptide located within the following region: DKQLTLNGIYTHITKNYPYYRTADKGWQRGESFAHVGNTRIRIGLPAHKA.
GeneID:
3607
Application WB
Background FOXK2 contains a fork head D binding domain. This protein can bind to the purine-rich motifs of the HIV long termil repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FOXK2 / ILF1 (2 products)

Catalog No. Species Pres. Purity   Source  

FOXK2 / ILF1

FOXK2 / ILF1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FOXK2 / ILF1

FOXK2 / ILF1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for FOXK2 / ILF1 (1 products)

Catalog No. Species Pres. Purity   Source  

FOXK2 overexpression lysate

FOXK2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn