TA345616 HKR1 antibody

Rabbit Polyclonal Anti-HKR1 Antibody

See related secondary antibodies

Search for all "HKR1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat HKR1

TA345616

More Views

  • TA345616
  • TA345616

Product Description for HKR1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat HKR1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for HKR1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Krueppel-related zinc finger protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P10072
Immunogen:
The immunogen for anti-HKR1 antibody: synthetic peptide directed towards the C terminal of human HKR1. Synthetic peptide located within the following region: RECGQGFSRQSHLIRHQRTHSGEKPYICRKCGRGFSRKSNLIRHQRTHSG.
GeneID:
284459
Application WB
IHC
Background HKR1 is one of the GLI-Kruppel family of human genes. Members of this family have similar H-C links, i.e., a conserved stretch of 9 amino acids connecting the C-termil histidine of one finger to the N-termil cysteine of the next. On the basis of amino acid sequence and intron-exon organization, the genes could be placed into one of two subgroups: the GLI subgroup (with the consensus finger amino acid sequence [Y/F]XCX3GCX3[F/Y]X5LX2HX3-4H[T/S]GEKP) or the Kr subgroup (with the consensus finger amino acid sequence [Y/F]XCX2CX3FX5LX2HXRXHTGEKP).
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HKR1 (2 products)

Catalog No. Species Pres. Purity   Source  

HKR1

HKR1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

HKR1

HKR1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn