TA345617 ZBTB12 antibody

Rabbit Polyclonal Anti-ZBTB12 Antibody

See related secondary antibodies

Search for all "ZBTB12"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat ZBTB12

Product Description for ZBTB12

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat ZBTB12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZBTB12

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C6orf46, G10, NG35, Zinc finger and BTB domain-containing protein 12
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y330
Immunogen:
The immunogen for anti-ZBTB12 antibody: synthetic peptide directed towards the N terminal of human ZBTB12. Synthetic peptide located within the following region: MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVI.
GeneID:
221527
Application WB
Background ZBTB12 may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZBTB12 (2 products)

Catalog No. Species Pres. Purity   Source  

ZBTB12

ZBTB12 Human Purified
  Abnova Taiwan Corp.

ZBTB12

ZBTB12 Human Purified
  Abnova Taiwan Corp.

Positive controls for ZBTB12 (2 products)

Catalog No. Species Pres. Purity   Source  

ZBTB12 293T Cell Transient Overexpression Lysate(Denatured)

ZBTB12 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZBTB12 overexpression lysate

ZBTB12 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn