TA345618 Bcl-6B antibody

Rabbit Polyclonal Anti-BCL6B Antibody

See related secondary antibodies

Search for all "Bcl-6B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Bcl-6B

Product Description for Bcl-6B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Bcl-6B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Bcl-6B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms B-cell CLL/lymphoma 6 member B protein, BAZF, BCL6B, Bcl6-associated zinc finger protein, ZNF62, Zinc finger protein 62
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N143
Immunogen:
The immunogen for anti-BCL6B antibody: synthetic peptide directed towards the middle region of human BCL6B. Synthetic peptide located within the following region: LQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVE.
GeneID:
255877
Application WB
Background BCL6B acts as a sequence-specific transcriptiol repressor in association with BCL6. BCL6B may function in a rrow stage or be related to some events in the early B-cell development.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Bcl-6B (4 products)

Catalog No. Species Pres. Purity   Source  

Bcl-6B

Bcl-6B Human Purified
  Abnova Taiwan Corp.

Bcl-6B

Bcl-6B Human Purified
  Abnova Taiwan Corp.

Bcl-6B

Bcl-6B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Bcl-6B

Bcl-6B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Bcl-6B (2 products)

Catalog No. Species Pres. Purity   Source  

BCL6B 293T Cell Transient Overexpression Lysate(Denatured)

BCL6B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

BCL6B Lysate

Western Blot: BCL6B Lysate [NBL1-07952] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for BCL6B Protein
  Novus Biologicals Inc.
  • LinkedIn