TA345682 ANP32A antibody

Rabbit Polyclonal Anti-ANP32A Antibody

See related secondary antibodies

Search for all "ANP32A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish ANP32A

TA345682

More Views

  • TA345682
  • TA345682
  • TA345682

Product Description for ANP32A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish ANP32A.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ANP32A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acidic leucine-rich nuclear phosphoprotein 32 family member A, Acidic nuclear phosphoprotein pp32, C15orf1, LANP, Leucine-rich acidic nuclear protein, MAPM, Mapmodulin, PHAP1, Potent heat-stable protein phosphatase 2A inhibitor I1PP2A, Putative HLA-DR-associated protein I
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Sh, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P39687
Immunogen:
The immunogen for anti-ANP32A antibody: synthetic peptide directed towards the middle region of human ANP32A. Synthetic peptide located within the following region: FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE.
GeneID:
8125
Application WB
IHC
Background ANP32A is a novel potent heat-stable inhibitor protein of protein phosphatase 2A. It may play a key role in self-renewing cell populations where it may act in the nucleus to limit their sensitivity to transformation. Being a tumor suppressor, ANP32A represses cell growth through inhibition of transcription by blocking acetylation and phosphorylation of histone H3 and initiating its proapoptotic activity.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ANP32A (7 products)

Catalog No. Species Pres. Purity   Source  

ANP32A

ANP32A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ANP32A (1-249, His-tag)

Recombinant human ANP32A, 1-249aa, His-tagged Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

ANP32A (1-249, His-tag)

Recombinant human ANP32A, 1-249aa, His-tagged Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

ANP32A

ANP32A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ANP32A

ANP32A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ANP32A

ANP32A Human Purified
  Novus Biologicals Inc.

ANP32A

ANP32A Human Purified
  Novus Biologicals Inc.

Positive controls for ANP32A (1 products)

Catalog No. Species Pres. Purity   Source  

ANP32A Lysate

Western Blot: ANP32A Lysate [NBL1-07550] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ANP32A Protein
  Novus Biologicals Inc.
  • LinkedIn