TA345709 DAZ4 antibody

Rabbit Polyclonal Anti-DAZ4 Antibody

See related secondary antibodies

Search for all "DAZ4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat DAZ4

Product Description for DAZ4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat DAZ4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DAZ4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Deleted in azoospermia protein 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86SG3-2
Immunogen:
The immunogen for anti-DAZ4 antibody: synthetic peptide directed towards the middle region of human DAZ4. Synthetic peptide located within the following region: ITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTA.
GeneID:
57135
Application WB
Background This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This R-binding protein is important for spermatogenesis.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn