TA345713 SF3B1 / SAP155 antibody

Rabbit Polyclonal Anti-SF3B1 Antibody

See related secondary antibodies

Search for all "SF3B1 / SAP155"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SF3B1 / SAP155

TA345713

More Views

  • TA345713
  • TA345713
  • TA345713

Product Description for SF3B1 / SAP155

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SF3B1 / SAP155.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SF3B1 / SAP155

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Pre-mRNA-splicing factor SF3b 155 kDa subunit, SAP 155, SAP-155, SF3b155, Spliceosome-associated protein 155, Splicing factor 3B subunit 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75533
Immunogen:
The immunogen for anti-SF3B1 antibody: synthetic peptide directed towards the N terminal of human SF3B1. Synthetic peptide located within the following region: MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR.
GeneID:
23451
Application WB
IHC
Background SF3B1 is subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S R unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mR upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mR. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-termil two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures.This gene encodes subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S R unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mR upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mR. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-termil two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures. Altertive splicing results in multiple transcript variants encoding different isoforms.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SF3B1 / SAP155 (1 products)

Catalog No. Species Pres. Purity   Source  

SF3B1 / SAP155 (transcript variant 2)

SF3B1 / SAP155 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for SF3B1 / SAP155 (1 products)

Catalog No. Species Pres. Purity   Source  

SF3B1 overexpression lysate

SF3B1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn