TA345747 TNRC6B antibody

Rabbit Polyclonal Anti-TNRC6B Antibody

See related secondary antibodies

Search for all "TNRC6B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat TNRC6B

Product Description for TNRC6B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat TNRC6B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TNRC6B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1093, Trinucleotide repeat-containing gene 6B protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UPQ9
Immunogen:
The immunogen for anti-TNRC6B antibody: synthetic peptide directed towards the N terminal of human TNRC6B. Synthetic peptide located within the following region: LQSESGTAPVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWG.
GeneID:
23112
Application WB
Background The function of TNRC6B remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TNRC6B (2 products)

Catalog No. Species Pres. Purity   Source  

TNRC6B

TNRC6B Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

TNRC6B

TNRC6B Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.
  • LinkedIn