TA345774 DKC1 / NOLA4 antibody

Rabbit Polyclonal Anti-DKC1 Antibody

See related secondary antibodies

Search for all "DKC1 / NOLA4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish DKC1 / NOLA4

Product Description for DKC1 / NOLA4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish DKC1 / NOLA4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DKC1 / NOLA4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CBF5 homolog, Dyskerin, H/ACA ribonucleoprotein complex subunit 4, Nopp140-associated protein of 57 kDa, Nucleolar protein NAP57, Nucleolar protein family A member 4, snoRNP protein DKC1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Sh, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60832
Immunogen:
The immunogen for anti-DKC1 antibody: synthetic peptide directed towards the N terminal of human DKC1. Synthetic peptide located within the following region: EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIG.
GeneID:
1736
Application WB
Background This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rR processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DKC1 / NOLA4 (4 products)

Catalog No. Species Pres. Purity   Source  

DKC1 / NOLA4

DKC1 / NOLA4 Human Purified
  Abnova Taiwan Corp.

DKC1 / NOLA4

DKC1 / NOLA4 Human Purified
  Abnova Taiwan Corp.

DKC1 / NOLA4

DKC1 / NOLA4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DKC1 / NOLA4

DKC1 / NOLA4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DKC1 / NOLA4 (4 products)

Catalog No. Species Pres. Purity   Source  

DKC1 293T Cell Transient Overexpression Lysate(Denatured)

DKC1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DKC1 Lysate

Western Blot: DKC1 Lysate [NBL1-09897] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for DKC1.
  Novus Biologicals Inc.

DKC1 overexpression lysate

DKC1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DKC1 overexpression lysate

DKC1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn