TA345814 RBM4 / RBM4A antibody

Rabbit Polyclonal Anti-RBM4 Antibody

See related secondary antibodies

Search for all "RBM4 / RBM4A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat RBM4 / RBM4A

TA345814

More Views

  • TA345814

Product Description for RBM4 / RBM4A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat RBM4 / RBM4A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RBM4 / RBM4A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Lark homolog, RNA-binding motif protein 4, RNA-binding motif protein 4a, RNA-binding protein 4, hLark
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BWF3
Immunogen:
The immunogen for anti-RBM4 antibody: synthetic peptide directed towards the middle region of human RBM4. Synthetic peptide located within the following region: TAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPY.
GeneID:
5936
Application WB
Background RBM4 contains 1 CCHC-type zinc finger and 2 RRM (R recognition motif) domains. It may play a role in altertive splice site selection during pre-mR processing. RBM4 is down-regulated in fetal Down syndrome (DS) brain.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RBM4 / RBM4A (1 products)

Catalog No. Species Pres. Purity   Source  

RBM4 / RBM4A

RBM4 / RBM4A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for RBM4 / RBM4A (1 products)

Catalog No. Species Pres. Purity   Source  

RBM4 overexpression lysate

RBM4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn