TA345888 SS-A / Ro60 / TROVE antibody

Rabbit Polyclonal Anti-TROVE2 Antibody

See related secondary antibodies

Search for all "SS-A / Ro60 / TROVE"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat SS-A / Ro60 / TROVE

TA345888

More Views

  • TA345888

Product Description for SS-A / Ro60 / TROVE

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat SS-A / Ro60 / TROVE.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SS-A / Ro60 / TROVE

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 60 kDa SS-A/Ro ribonucleoprotein, 60 kDa ribonucleoprotein Ro, Ro 60 kDa autoantigen, RoRNP, SSA2, Sjoegren syndrome antigen A2, Sjoegren syndrome type A antigen, TROVE domain family member 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P10155
Immunogen:
The immunogen for anti-TROVE2 antibody: synthetic peptide directed towards the N terminal of human TROVE2. Synthetic peptide located within the following region: QKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS.
GeneID:
6738
Application WB
IHC
Background As a R-binding protein, TROVE2 binds to several small cytoplasmic R molecules known as Y Rs. It may stabilize these Rs from degradation.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SS-A / Ro60 / TROVE (12 products)

Catalog No. Species Pres. Purity   Source  

SS-A / Ro60 / TROVE (transcript variant 3)

SS-A / Ro60 / TROVE Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human Purified > 90.0% as determined by both both RP-HPLC and SDS-PAGE analysis E. coli
  OriGene Technologies GmbH

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human Purified > 90.0% as determined by both both RP-HPLC and SDS-PAGE analysis E. coli
  OriGene Technologies GmbH

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human Purified > 90.0% as determined by both both RP-HPLC and SDS-PAGE analysis E. coli
  OriGene Technologies GmbH

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human Purified > 90 % pure as determined by SDS-PAGE. E. coli
  OriGene Technologies GmbH

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human Purified > 90 % pure as determined by SDS-PAGE. E. coli
  OriGene Technologies GmbH

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human Purified > 90 % pure as determined by SDS-PAGE. E. coli
  OriGene Technologies GmbH

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human in vitro transl.
  Abnova Taiwan Corp.

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human in vitro transl.
  Abnova Taiwan Corp.

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SS-A / Ro60 / TROVE

SS-A / Ro60 / TROVE Human Purified > 96 % Insect cells
  BBI Solutions

Positive controls for SS-A / Ro60 / TROVE (3 products)

Catalog No. Species Pres. Purity   Source  

TROVE2 293T Cell Transient Overexpression Lysate(Denatured)

TROVE2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TROVE2 overexpression lysate

TROVE2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

TROVE2 overexpression lysate

TROVE2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn