TA345938 SF3A1 / SAP114 antibody

Rabbit Polyclonal Anti-SF3A1 Antibody

See related secondary antibodies

Search for all "SF3A1 / SAP114"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SF3A1 / SAP114

TA345938

More Views

  • TA345938

Product Description for SF3A1 / SAP114

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SF3A1 / SAP114.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SF3A1 / SAP114

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SAP 114, SAP-114, SF3a120, Spliceosome-associated protein 114, Splicing factor 3A subunit 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15459
Immunogen:
The immunogen for anti-SF3A1 antibody: synthetic peptide directed towards the N terminal of human SF3A1. Synthetic peptide located within the following region: RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQ.
GeneID:
10291
Application WB
Background SF3A1 is the subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mR splicing. Subunit 1 belongs to the SURP protein family; med for the SURP motifs that are thought to mediate R binding. Subunit 1 has tandemly repeated SURP motifs in its amino-termil half while its carboxy-termil half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-termil to the SURP motifs. This gene encodes subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mR splicing. Subunit 1 belongs to the SURP protein family; med for the SURP (also called SWAP or Suppressor-of-White-APricot) motifs that are thought to mediate R binding. Subunit 1 has tandemly repeated SURP motifs in its amino-termil half while its carboxy-termil half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-termil to the SURP motifs. Altertive splicing results in multiple transcript variants encoding different isoforms.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SF3A1 / SAP114 (5 products)

Catalog No. Species Pres. Purity   Source  

SF3A1 / SAP114 (transcript variant 1)

SF3A1 / SAP114 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SF3A1 / SAP114

SF3A1 / SAP114 Human Purified
  Abnova Taiwan Corp.

SF3A1 / SAP114

SF3A1 / SAP114 Human Purified
  Abnova Taiwan Corp.

SF3A1 / SAP114

SF3A1 / SAP114 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SF3A1 / SAP114

SF3A1 / SAP114 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SF3A1 / SAP114 (1 products)

Catalog No. Species Pres. Purity   Source  

SF3A1 Lysate

Western Blot: SF3A1 Lysate [NBL1-15874] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for SF3A1.
  Novus Biologicals Inc.
  • LinkedIn