TA345945 GNB2L1 / HLC7 antibody

Rabbit Polyclonal Anti-GNB2L1 Antibody

See related secondary antibodies

Search for all "GNB2L1 / HLC7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish GNB2L1 / HLC7

TA345945

More Views

  • TA345945

Product Description for GNB2L1 / HLC7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish GNB2L1 / HLC7.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for GNB2L1 / HLC7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cell proliferation-inducing gene 21 protein, G protein beta 2 like 1, Guanine nucleotide-binding protein subunit beta-2-like 1, Human lung cancer oncogene 7 protein, PIG21, RACK1, Receptor for activated C kinase, Receptor of activated protein kinase C 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Sh, Ye, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P63244
Immunogen:
The immunogen for anti-GNB2L1 antibody: synthetic peptide directed towards the C terminal of human GNB2L1. Synthetic peptide located within the following region: LEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW.
GeneID:
10399
Application WB
IHC
Background GNB2L1 seems to bind protein kise C acting as an intracellular receptor to anchor the activated PKC to the cytoskeleton.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GNB2L1 / HLC7 (6 products)

Catalog No. Species Pres. Purity   Source  

GNB2L1 / HLC7

GNB2L1 / HLC7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GNB2L1 / HLC7 (1-317, His-tag)

GNB2L1 / HLC7 Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

GNB2L1 / HLC7 (1-317, His-tag)

GNB2L1 / HLC7 Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

GNB2L1 / HLC7

GNB2L1 / HLC7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GNB2L1 / HLC7

GNB2L1 / HLC7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GNB2L1 / HLC7

GNB2L1 / HLC7 Human Purified
  Novus Biologicals Inc.

Positive controls for GNB2L1 / HLC7 (1 products)

Catalog No. Species Pres. Purity   Source  

GNB2L1 Lysate

Western Blot: GNB2L1 Lysate [NBL1-11166] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GNB2L1
  Novus Biologicals Inc.
  • LinkedIn