TA345949 PCBP1 antibody

Rabbit Polyclonal Anti-PCBP1 Antibody

See related secondary antibodies

Search for all "PCBP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PCBP1

TA345949

More Views

  • TA345949
  • TA345949
  • TA345949

Product Description for PCBP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PCBP1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for PCBP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Alpha-CP1, HNRPE1, HNRPX, Heterogeneous nuclear ribonucleoprotein E1, Nucleic acid-binding protein SUB2.3, Poly(rC)-binding protein 1, SUB2.3, hnRNP E1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15365
Immunogen:
The immunogen for Anti-PCBP1 antibody is: synthetic peptide directed towards the middle region of Human PCBP1. Synthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF.
GeneID:
5093
Application IHC
WB
Background PCBP1 appears to be multifunctiol. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in R binding. This protein together with PCBP-2 also functions as translatiol coactivators of poliovirus R via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus R replication by binding to its 5'-termil cloverleaf structure. It has also been implicated in translatiol control of the 15-lipoxygese mR, human Papillomavirus type 16 L2 mR, and hepatitis A virus R. PCBP1 is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mR stability.This intronless gene is thought to be generated by retrotransposition of a fully processed PCBP-2 mR. This gene and PCBP-2 has paralogues PCBP3 and PCBP4 which is thought to arose as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctiol. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. It contains three K-homologous (KH) domains which may be involved in R binding. This encoded protein together with PCBP-2 also functions as translatiol coactivators of poliovirus R via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus R replication by binding to its 5'-termil cloverleaf structure. It has also been implicated in translatiol control of the 15-lipoxygese mR, human Papillomavirus type 16 L2 mR, and hepatitis A virus R. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mR stability.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PCBP1 (7 products)

Catalog No. Species Pres. Purity   Source  

PCBP1

PCBP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PCBP1 (1-163, His-tag)

PCBP1 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

PCBP1 (1-163, His-tag)

PCBP1 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

PCBP1

PCBP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PCBP1

PCBP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PCBP1

PCBP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PCBP1

PCBP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PCBP1 (1 products)

Catalog No. Species Pres. Purity   Source  

PCBP1 Lysate

Western Blot: PCBP1 Lysate [NBL1-14142] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for PCBP1.
  Novus Biologicals Inc.
  • LinkedIn